Protein Info for Echvi_2789 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00561: Abhydrolase_1" amino acids 24 to 258 (235 residues), 124.5 bits, see alignment E=9.1e-40 PF12146: Hydrolase_4" amino acids 26 to 258 (233 residues), 62.5 bits, see alignment E=5.6e-21 PF12697: Abhydrolase_6" amino acids 26 to 266 (241 residues), 74.5 bits, see alignment E=3.1e-24

Best Hits

Swiss-Prot: 45% identical to ESTE_PSEFL: Arylesterase from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 66% identity to cat:CA2559_12958)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G171 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Echvi_2789 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Echinicola vietnamensis KMM 6221, DSM 17526)
MPFLINETGKDPVDLYYKDYGKGKPVILIHGWPLSHQAWEGQTQTLLDAGYRVISYDRRG
FGLSSQPLEGYDYSSLTSDLREIILQLDLQDVTIVGFSMGGGEVVRYFTDFGGDRVKKAV
LIGSIIPLVAQKTDNPDGVPADMLNGILDALKSNRIGFLKDFHKNFYNYENNTDRMSQAN
LDYDFSIASHASPIATIKCAEAWAGTDFRPELKNVSVPTLIIHGDEDNIVPIKSASDQAA
KGITANEYHVISGGPHGLTLTHRDEVDKLLLDFLKK