Protein Info for Echvi_2740 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type multidrug transport system, ATPase and permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 174 to 203 (30 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details PF00664: ABC_membrane" amino acids 21 to 320 (300 residues), 132.1 bits, see alignment E=3.3e-42 PF00005: ABC_tran" amino acids 382 to 531 (150 residues), 113.7 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 41% identical to MSBA_DESPS: Lipid A export ATP-binding/permease protein MsbA (msbA) from Desulfotalea psychrophila (strain LSv54 / DSM 12343)

KEGG orthology group: None (inferred from 74% identity to dfe:Dfer_0316)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2A1 at UniProt or InterPro

Protein Sequence (608 amino acids)

>Echvi_2740 ABC-type multidrug transport system, ATPase and permease components (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTYFRLLAFAKPIEKFAIPYLIFTLLGVIFNTLNLALLAPLLSTLFNTNGREEVVKPES
WTDVFGYLNFYANEVKMEYGALGALQMVCAVIIASVILGNLFRYFSQLVMENLRIHTLLN
LRKKVFDNVMNLHVGYFSNQRKGDIISKISSDVQVVQFSVTGTLQVIFKEPLQLLAYIFM
LFAISYKLTIFSLLVIPVSAFVIAKIVKRLKAQASQAQHLYGVMISYLDEALSGIKIIKA
FNATEMIKDKFHDENIKYSSLGKKMAKRQQLSSPVSETLGVAMVSGIVLYGGSLIINNQS
ELSASDFIAYIALFSQVMRPAKALTNAFSSIHSGLAAGERVLDLIDEKPAISDQKDAIEI
TAFNDKIDIQDLSFSYPGRPVLKDINLTIPKGKMVALVGPSGGGKSTMMDLIPRFIEPDS
GQVLIDGTDIAHVTMDSLRNMMGMVNQESILFNDTIFNNIAFGTPNATAEEVEAAAKIAN
AHEFIVQSENGYQSNMGDRGLKLSGGQKQRICIARAVLKNPPIMLLDEATSALDTESEKL
VQDALNKLMKNRTSLVIAHRLSTIQNADIIVVLEEGRIIEQGNHQELMTQEGLYSKLVNM
QQFSEIEE