Protein Info for Echvi_2739 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferases involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13641: Glyco_tranf_2_3
  • amino acids 7 to 111 (105 residues), 57.1 bits, E=3.9e-19
• PF00535: Glycos_transf_2
  • amino acids 8 to 171 (164 residues), 103.3 bits, E=2.1e-33
• PF10111: Glyco_tranf_2_2
  • amino acids 9 to 111 (103 residues), 28.1 bits, E=2.2e-10

Predicted SEED Role

"Alpha-L-Rha alpha-1,3-L-rhamnosyltransferase (EC 2.4.1.-)" in subsystem Rhamnose containing glycans (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See L0FYI9 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Echvi_2739 Glycosyltransferases involved in cell wall biogenesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MNSQPLVSIALCTYNGKKYLPEQLDSILNQSYQNLEIVVVDDKSTDGTIDLLESYKNKYP
HKISLFQNSINLGFNSNFEKAISLCKGDLIAISDQDDLWIKDKISLQVNYIKENLLIYHD
SLMVDKNGQSLNIKISDMRNMYSGDNPNVFIFNNCVSGHSILMKKELLQYIFPFPKMVYY
DWWIAYQATQFGSIEYLNQCLVHYKQHEDTITGSNLTTKSNDTVASKVEKVVKALANTEN
RKNRELIIKLDRLFDERNKKLLNLKLFYLFYKNRKEFLFISNKSYLSKLNRVLKNLWSKN
VHA