Protein Info for Echvi_2719 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: amino acid carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 243 to 263 (21 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 418 to 438 (21 residues), see Phobius details amino acids 449 to 470 (22 residues), see Phobius details amino acids 481 to 500 (20 residues), see Phobius details amino acids 534 to 556 (23 residues), see Phobius details amino acids 576 to 600 (25 residues), see Phobius details amino acids 620 to 641 (22 residues), see Phobius details amino acids 647 to 666 (20 residues), see Phobius details PF13573: SprB" amino acids 36 to 60 (25 residues), 32.4 bits, see alignment (E = 5.9e-12) TIGR00835: amino acid carrier protein" amino acids 246 to 673 (428 residues), 400.9 bits, see alignment E=3.3e-124 PF01235: Na_Ala_symp" amino acids 284 to 681 (398 residues), 421.4 bits, see alignment E=4.7e-130

Best Hits

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 70% identity to zpr:ZPR_1150)

Predicted SEED Role

"Na(+)-linked D-alanine glycine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYG8 at UniProt or InterPro

Protein Sequence (695 amino acids)

>Echvi_2719 amino acid carrier protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MCKYLFTIILTLNLINLQAQDLEIITTPGNPTKLINDGYIEAEVKGGTPPYTYQWSNPST
PMDANRAEGLVEGIHYTLTVTDSEGKTASTKAKVKSQSVTETFNGAFTPLVEGLTDFLFW
DPFAAIGIYDPVVYNKSKNVEIPGWKAGVKDQFTLQEWKIGNQQHVNKGDTIATVLSQND
GAIAVVAPENGTIKHSIKEGAVIYDAQNTEDLIETNAHVFGKIKYDEPVILTHPNGDPQT
HPIPFIVIWLVVGAAFFTFKMGFINIRGFRHAIGLATGKYDEPDAPGKISHFQAFATATS
ATVGLGNIAGVAIAISLGGPGATFWIIIAGFLGMSSKFTECTLGLKYRHIAKDGKIFGGP
MNYLKHGLERRNMKNLGKVLAAVFAIFCVAFSFGGGNMFQANQSYKILATQFPVLEGFGF
WVGVILAILVGVVIIGGIESIAKVTEKIVPFMAGLYIFGALVVIFVNIGNIGQAFNAIWD
GAFNATAMKGGFIGVLVVGFQRGVFSNEAGTGSAAIAHSAVKTNNPPSEGFVGLLEPFVD
TIVVCTLTALVIIFTGKHEAQGMGGVELTSQAFASVISWFPYLLAIAVLLFAFSSMVSWS
YYGLRSWTYLFGKSKRSELAYKLVFVVFVVIGASISLGAVLDFSDMMILSMSFPNIIGLY
IMSGEVRNDMNSYLKKLKNGELFKKDKANKEEALP