Protein Info for Echvi_2698 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1042 TIGR00229: PAS domain S-box protein" amino acids 6 to 119 (114 residues), 41.5 bits, see alignment E=6.6e-15 amino acids 295 to 413 (119 residues), 45.3 bits, see alignment E=4.6e-16 amino acids 583 to 701 (119 residues), 53.9 bits, see alignment E=9.9e-19 amino acids 718 to 829 (112 residues), 38.8 bits, see alignment E=4.6e-14 PF13188: PAS_8" amino acids 6 to 51 (46 residues), 17.6 bits, see alignment (E = 1.1e-06) amino acids 585 to 632 (48 residues), 19.2 bits, see alignment 3.7e-07 PF13426: PAS_9" amino acids 13 to 114 (102 residues), 18.1 bits, see alignment E=1e-06 amino acids 312 to 389 (78 residues), 13.5 bits, see alignment 2.9e-05 amino acids 603 to 693 (91 residues), 19.6 bits, see alignment E=3.7e-07 PF01590: GAF" amino acids 148 to 285 (138 residues), 37.2 bits, see alignment E=1.6e-12 PF00989: PAS" amino acids 300 to 404 (105 residues), 24.8 bits, see alignment E=7.2e-09 PF08448: PAS_4" amino acids 309 to 411 (103 residues), 25.6 bits, see alignment E=5e-09 PF08447: PAS_3" amino acids 323 to 393 (71 residues), 40 bits, see alignment 1.5e-13 amino acids 730 to 816 (87 residues), 52.8 bits, see alignment E=1.6e-17 amino acids 867 to 945 (79 residues), 47.4 bits, see alignment 7.5e-16 PF14598: PAS_11" amino acids 329 to 395 (67 residues), 32.1 bits, see alignment 4e-11

Best Hits

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0W1 at UniProt or InterPro

Protein Sequence (1042 amino acids)

>Echvi_2698 PAS domain S-box (Echinicola vietnamensis KMM 6221, DSM 17526)
MPENIIFDQSPFPMWIYDLETYQFLAVNNEAVVHYGYSKSEFLDMTIREIRPKEDIALLE
RAVAAVREGNKLFKDNLFRHKLKNGTIIQVKIKSNPIEYHGRRAEIVTAIDLTESHLQQK
HIERQKNHLSAIRDIQEILLKSKQWPSALKTCLEKVGKLLKADRLFFSKWDEKTLPSVPF
ISWTSQSSDEPPVDSVSSLLFHFPPCRAHLETGKSFKFNTTHLCDPDLRSTLVGLKIKSM
VLVPIMMRQKPVGVIAMEDHAHEKNWEEMEIQLLERLSGNLSYAIKEAISYQKLKESEVR
FRSLVQNGTDLIALLDDHGNYKYVAPTSTRVLGIPPESFLGKNAFEFIHPDDTPKVMKKL
KEISQKSHVTVPPYRFTDVKGNYVWLHTELSNHLNDPSIHGVIANTQVVTDEMEKRKTSD
LAAAMANALGQSSTLSKGMSRAIAKINQLTGTDCGEFWLVSKDGLQLNLMAKHHSAAPFA
KLYKKGDMDTLAKGQGLPGKCWSSNSIEIWEELAHEPLFIRKKRFSQTSLKSAFAIPVRH
NDHFLGVFLGFSTEDILVLNSDIRIVKAVFDPTGAIVRQKLIEEEFRNFFDLSPGPLCII
GYDGYIKKHNRALEKLLGYHKKELLHYPLLDLIYTKDGGLSLKRMNAFLEGKTQLPQETK
FLTKTGKVKSLIWKGRQLPESKIIIAVAKDITDQKQAQNNLKEAYTKLKTAQKIGKMGYW
SRDINSDISEWSEETYKIYGYSQKEFVPTMDNLLKTFHPDDQYLLEHDPIKSLKPGKVNR
FQHRIINGKGKTKWVQQEIKLVTNKEGTPTRLEGTIRDITDQKEHEQKLSISNNRFKLAM
KVSNEMIWELDFSTGTITRGTRMGKEVGYKGSESFTKGNSWFQKIHPEDAESVWKSLQQS
LSNKTAKSWKKEYRLLLSDNRISYVVDRCLILRNDTGKPVRAVGSVLDVTSSRKHLKKIT
QQNNHLKEIAWLQSHQIRAPLSRIMGLVSMYREVDDDDIPLAQILDWIENSCKELDKVVH
EITARTIDEGIPIVPDDPNRTI