Protein Info for Echvi_2682 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Domain of unknown function (DUF303).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF03629: SASA" amino acids 110 to 217 (108 residues), 33.3 bits, see alignment E=2.1e-12 amino acids 421 to 539 (119 residues), 50.9 bits, see alignment E=8.4e-18

Best Hits

Predicted SEED Role

"Sialic acid-specific 9-O-acetylesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G041 at UniProt or InterPro

Protein Sequence (656 amino acids)

>Echvi_2682 Domain of unknown function (DUF303). (Echinicola vietnamensis KMM 6221, DSM 17526)
MKVGLNIRSVICLIVILILKAHWSYGAVKLPYLISDGMVLQRNHEIRIWGWADAGEVVKV
DFVGEMKETTTGTDGMWEVIFPARAAGGPYEMNIIGNDHSFLLKDVWIGDVWVCSGQSNM
EQTMARVEPMFPDEVKNANNPKIRYFDVPDAYDFSTPQLDVTGGKWVAADQENIKQFSAV
AYFFAQKVHRKYGIPIGLINASVGGSPIQSWIREKELKRFPEDYKEAVRFQNPNLIKAIE
EEDRDNRRKWHLEVRKKDKGYADQSMTWLDAKYHPENWNVMERLDLLPVEKGKQPGNGVY
WFRKEFYLEQDQVGELEAKLLLGTIVDSDSAYVNGELVGTTAYQYPPRRYSVPKGVLKPG
KNLLVVRVINERGRGGFVKDKPYQIEVGEEVVDLKNDWIYKQGAVMPPMPGQTFIRFKPL
GLYHAMISPLHEFPVKGVLWYQGESNAGQPHTYEDQMVSLIEGWRKSWGVPKLPFLFVQL
PNFMAPTDDPHSGNWPELREAQRKTLKVPHTGMAVTIDVGEANDIHPLDKKTVGERLALQ
AFKVAYGEKKGPFSGPELKKVKVKGSKIILTFEEIGEGLNTKEGRPPKGFAVAGKGQNYQ
WVAAKIANNKVVLDCSHIEQPEKVCYAWANNPVQANLVNEKGLPASPFEVVIDDPR