Protein Info for Echvi_2640 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00702: Hydrolase" amino acids 8 to 190 (183 residues), 39.9 bits, see alignment E=6.3e-14 PF13419: HAD_2" amino acids 133 to 194 (62 residues), 25.5 bits, see alignment E=1.3e-09 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 138 to 196 (59 residues), 39.3 bits, see alignment E=3.7e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZZ8 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Echvi_2640 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED (Echinicola vietnamensis KMM 6221, DSM 17526)
MKIDKNIDFFVFDLVGVIIDLDIPFTVNQLGKLLESNGNHQSIDFMAHPVHHAFEKGEIS
DVVFRNEIRKTFNQQWSDQEIDQIWNGMLKNIPLQKIKLLKDLRKTHPVYMLSNTNSIHF
KRVEEILLADTGETSFSGLFDHLFLSHEMGCRKPDTVIYEKVLEKIGMPAEKGVFFDDTA
PNLIGAEKVGLRTVHINHPNALMDYFSDVH