Protein Info for Echvi_2637 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted esterase of the alpha-beta hydrolase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01734: Patatin" amino acids 35 to 224 (190 residues), 120 bits, see alignment E=2.4e-38 PF07244: POTRA" amino acids 334 to 376 (43 residues), 24.4 bits, see alignment 6.1e-09 PF19143: Omp85_2" amino acids 399 to 482 (84 residues), 24.7 bits, see alignment E=2.1e-09 amino acids 629 to 775 (147 residues), 28.3 bits, see alignment E=1.8e-10

Best Hits

Predicted SEED Role

"putative patatin-like phospholipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY84 at UniProt or InterPro

Protein Sequence (780 amino acids)

>Echvi_2637 Predicted esterase of the alpha-beta hydrolase superfamily (Echinicola vietnamensis KMM 6221, DSM 17526)
MHHKSFFFTGLFCLLFPFVLFAQQHGESPRPKIGLVLSGGGAKGIAHVGVIKAMEEAGLR
PDYIVGTSMGAVIGGLYAIGYNADELESIVLKADWDLIVSNRVSFNTIAFEEKEYYNRYV
FELPVIKGKIAVPAGLIEGQKLTETLHYYTWPSIQYQDFDAFPIPFRCVTTDLKTGKGIV
IESGYLADALRSSIAIPSAFTPFELDSTLVVDGGVVNNFPVDVAQDMGADIIIGVNVGEE
DFLDPKELDSFSSILMQIAMASSYRKLSTNISGCDIYIKPDLKDYNTASFSSFKEILQLG
HQAGEENFPVFKQLADSLDSHRKSAGIGLGVQPVRISNISITGNRLFSDELIRSKLGISP
KDTVTREDVQSGVDRVFGVNGFRKVDYNLKPDGAGEYELFLKAKEKHNTILRGAFHYDNL
FSAGILLNLTVRDLLGKPSRTVGILDVSQNPKFRLDHYKYLGSNKKFALNLRYNYLFQQI
PEYEDGVRQDLFLNRETHIGANILTTHSLKQSFWFGGFYERSRAQSSFNISIPSEIRGAY
YTYMGVRFMHTRNSLNDRNYPTKGAETIFEGLFRAYSDYRIKLRPGVDTLTLGQGGETVK
IPKEVLDETLEGITPSGFVSLYFNYVKYFPINDHFQVSPTIAMGLTLSGQGDDYSYSEFT
LGGYQRVDFNDTPIWGLNYAELTAENFGKLGVNFQWLPTKKLYLRMGTNLLGHGYHSPLG
DGDGVDFDEFFEDRLIWGYGIDLTLDSFLGPITGGLSSNAKDGVIRPYLSIGFSFNYSDR