Protein Info for Echvi_2634 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 TIGR01027: glutamate 5-kinase" amino acids 14 to 266 (253 residues), 216 bits, see alignment E=4.5e-68 PF00696: AA_kinase" amino acids 14 to 245 (232 residues), 143 bits, see alignment E=6.5e-46

Best Hits

Swiss-Prot: 37% identical to PROB_NATPD: Glutamate 5-kinase (proB) from Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / NBRC 14720 / NCIMB 2260 / Gabara)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 73% identity to rbi:RB2501_13504)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11)" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.11

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1J3 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Echvi_2634 glutamate 5-kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKNTKMDNNEGPKRIVIKVGTNVMTNRDNRIVNTVLRKMVDQIAILYERGIMSVLVSSG
SVIAGKEVLGSKVGIKDKIIRRQVFSAVGQPRMMRHYYNIFQDYGMRCAQVLATKRDFDP
GKHRENMINCYEGLLSEGIIPIANEDDAVSLSMSTFTDNDELASLVAELTKADMLILLTD
TDGLYNGHPDDENTERIAHVGTDEKVEHFIQESTKGEAEGRGGMKSKLNVAKEAARKNIP
TYIANGNVDNMILDIVDGKEVGTKVSDD