Protein Info for Echvi_2633 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): gamma-glutamylphosphate reductase (EC 1.2.1.41)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00407.
Original annotation: gamma-glutamyl phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00407: glutamate-5-semialdehyde dehydrogenase
  • amino acids 1 to 388 (388 residues), 356.9 bits, E=6.6e-111
• PF00171: Aldedh
  • amino acids 5 to 263 (259 residues), 29.1 bits, E=2e-11
  • amino acids 300 to 356 (57 residues), 24.3 bits, E=5.8e-10

Best Hits

Swiss-Prot: 39% identical to PROA2_BACLD: Gamma-glutamyl phosphate reductase 2 (proA2) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 70% identity to gfo:GFO_1963)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

• L-citrulline biosynthesis (8/8 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-N^δ-acetylornithine biosynthesis (6/7 steps found)
• L-ornithine biosynthesis II (3/3 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

See L0G1Y7 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Echvi_2633 gamma-glutamylphosphate reductase (EC 1.2.1.41) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKILSTQKKNDVLASMIKIIDKNREKILTANKADLDAFQRDDQALYDRLVVNDAKIDGMI
QAVQEVKDQDDPVGKEISKRTLANGLDITNKTAPFGTIMIIYESRPDVTIEAAVLAFKAN
SKILLKGGKEAVNSNKVLVECWHEALEENGLSKDWIELFTLNREQTQAFLKNPSEKLDLI
VPRGGERLIAFVKEHAQCAVLVSGRGNNFAYVAEDADWELAKKVIINAKTNKISGCNALD
KILVDEKLPDFESKLADLAKSLASYKVELVAEKELVPAIEGAKEVPSEDTWYEEFLALKA
LIGKVNGLDEAIAKINKYSGGHSATILTTDKDKAATFMEQVDSAAVYHNASTRFTDGGQM
GVGAELAISTDKLHHRGPLGLEQLVTNKYYVFGSGQIRD