Protein Info for Echvi_2626 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 59 to 83 (25 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details PF06912: DUF1275" amino acids 18 to 224 (207 residues), 112.6 bits, see alignment E=1.1e-36

Best Hits

KEGG orthology group: None (inferred from 54% identity to fte:Fluta_3885)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0N3 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Echvi_2626 Predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MLRKFSNSRTLSDNIKLGSLTAFSAGMVNVVSVMLFFAFTSNVTGHYAVLAEEIAKGNWY
QAGVVAAWIMLFFFGGFTSNCIIIHFNKRYTYLAHAVPVFLEILCLLVVGTYVQFYYAET
LLETEWLVGLMLYAMGIQNGLTASISNSAVKTTHLTGLTTDLGMLFSMFTKKEYRENPQL
RGKLKIQLSIMVSYMSGGITAGFIYMTIAYNVFYIVCLFLLIVIGYDYYKLKYYELVNRR
DRKSKKDFYRYIGVKNKKKILEKA