Protein Info for Echvi_2622 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF00072: Response_reg" amino acids 4 to 114 (111 residues), 101.9 bits, see alignment E=2.4e-33 PF00486: Trans_reg_C" amino acids 154 to 227 (74 residues), 88.6 bits, see alignment E=2.3e-29

Best Hits

Swiss-Prot: 48% identical to MPRA_MYCVP: Response regulator MprA (mprA) from Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)

KEGG orthology group: K07665, two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR (inferred from 64% identity to zpr:ZPR_0969)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY68 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Echvi_2622 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKILLVEDDSRVSAFIIKGLQEEGYDVALAMDGKTGLQMALQGNYDLVILDIMIPEMNG
IEVCKALRKQHTHVPVLFLTALGSTENVVMGLDSGADDYLSKPFKFIELLARVRTLMRRS
TYSSGSESKTESTYQFGDLELDDETKTVLRNGMAISLTSTEYRLLLMFMKNQRRVLSRID
ILEEVWGIDFDMGTNVVDVYVNYLRKKLEKYQGPRLIQTVIGMGYVLKEAE