Protein Info for Echvi_2610 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Esterase/lipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00135: COesterase" amino acids 50 to 182 (133 residues), 49.9 bits, see alignment E=3.8e-17 PF20434: BD-FAE" amino acids 50 to 151 (102 residues), 80.5 bits, see alignment E=2e-26 PF07859: Abhydrolase_3" amino acids 64 to 148 (85 residues), 64.1 bits, see alignment E=2.4e-21

Best Hits

KEGG orthology group: None (inferred from 66% identity to fjo:Fjoh_2198)

Predicted SEED Role

"Probable lipase (EC 3.1.1.1)" (EC 3.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZW8 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Echvi_2610 Esterase/lipase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKASISILFVMICFWGIAQEIDYTTQKDIPYYDAAIREDDAYTKSRCVLDLYYPTNKAG
FSTVVWFHGGGLSAGQKEIPEALKEKGIAVVGVNYRLYPKIGAPVYIEDAAAAIAWTMKH
IADYGGDPSKVFLSGHSAGGYLAAMVGLDKKWLAQHDLDADDLAGLIPFSGHMITHFTVR
EERGIPGTQPIIDELAPLYHVRPDAPPLLLITGDREMEMLGRYEENAYMMRMMKVAGHTE
TTLYEMDGYGHNMTYPAFPLLLNEVNRIEGLED