Protein Info for Echvi_2593 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type polysaccharide/polyol phosphate transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF00005: ABC_tran" amino acids 62 to 193 (132 residues), 82.8 bits, see alignment E=1.8e-27

Best Hits

Predicted SEED Role

"Teichoic acid export ATP-binding protein TagH (EC 3.6.3.40)" in subsystem Rhamnose containing glycans or Teichoic and lipoteichoic acids biosynthesis (EC 3.6.3.40)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1V0 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Echvi_2593 ABC-type polysaccharide/polyol phosphate transport system, ATPase component (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKPIIKVENVSKRYRLGLKERRSKTLAGQVGNILKSPWENFQRLRKLSKFGEEDESVFW
ALKDINFEVNEGEVLGIIGKNGAGKSTLLKILSQITEPTSGRITLNGRVASLLEVGTGFH
PELTGRENIYMNGTILGMTRREIDRKLDEIIDFSGIEKFVDTPVKFYSSGMKVRLGFSVA
AHLEPEILVIDEVLAVGDYEFQQKCLGKMEDVSKNQGRTVLFVSHNMGAVRNLCSRAILI
ENGSIKCESGTSEVLKVYVEKDSILGTSKMLLTNHPDKKLKGIGLLSACIKVDGEETNSI
TTGQSLEIILDYKVKVSHLNMPMEIGFGLFDSELNGLLAFNNRNFRKLVKLNNTEGKVII
RIDEFPMYRDELLSLSFYFGYLDTEYEVLHNVGKIRAVTSDYLRSSYPFNSRLNQYQLKN
VTYSVI