Protein Info for Echvi_2592 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type polysaccharide/polyol phosphate export systems, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 43 to 66 (24 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 118 to 145 (28 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details PF01061: ABC2_membrane" amino acids 27 to 233 (207 residues), 70.7 bits, see alignment E=6.8e-24

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 58% identity to dde:Dde_0841)

Predicted SEED Role

"O-antigen export system, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY40 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Echvi_2592 ABC-type polysaccharide/polyol phosphate export systems, permease component (Echinicola vietnamensis KMM 6221, DSM 17526)
MSSKIIEPSKGWKLVDFRELWRYKDLLYFLTLRGIKARYAQSILGVAWAIIQPLFTTLVF
TVVFGNLAKVDSDGMPYILFSYLALWPWNYFSGTLTESANSLIANSGMITKVYFPRMVLP
LASIFAKLLDFIIAFLVVIGFLVYFKVMPGWGLIFLPLLIVQLLLTSLGMGMILSAMAVQ
YRDVKHALTFLVQLLMYAAPVVYSTTAVPEAYRPLYILNPMVGVIEGFRAAFLDRPMPWE
WIWPGAVVALVLFVFGMFYFRRMERVFADVA