Protein Info for Echvi_2567 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 30 to 420 (391 residues), 326.8 bits, E=1.7e-101
• PF13193: AMP-binding_C
  • amino acids 470 to 544 (75 residues), 73.3 bits, E=2.6e-24

Best Hits

Swiss-Prot: 55% identical to LCFA_YERPE: Long-chain-fatty-acid--CoA ligase (fadD) from Yersinia pestis

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 62% identity to mtt:Ftrac_0905)

MetaCyc: 53% identical to medium-chain-fatty-acid--CoA ligase (Pseudomonas aeruginosa PAO1)
Butyrate--CoA ligase. [EC: 6.2.1.2, 6.2.1.3]

Predicted SEED Role

"Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)" in subsystem Biotin biosynthesis or n-Phenylalkanoic acid degradation (EC 6.2.1.3)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate β-oxidation (27/35 steps found)
• fatty acid salvage (5/6 steps found)
• γ-linolenate biosynthesis II (animals) (2/2 steps found)
• long-chain fatty acid activation (1/1 steps found)
• palmitate biosynthesis III (21/29 steps found)
• phytol degradation (3/4 steps found)
• oleate biosynthesis I (plants) (2/3 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• valproate β-oxidation (6/9 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• alkane biosynthesis II (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• stearate biosynthesis IV (3/6 steps found)
• octane oxidation (2/5 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• phosphatidylcholine acyl editing (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (2/7 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• 2-deoxy-D-ribose degradation II (2/8 steps found)
• capsaicin biosynthesis (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• 4-oxopentanoate degradation (1/9 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• sporopollenin precursors biosynthesis (4/18 steps found)
• cutin biosynthesis (1/16 steps found)
• suberin monomers biosynthesis (2/20 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Fatty acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.2 or 6.2.1.3

Sequence Analysis Tools

See L0FY15 at UniProt or InterPro

Protein Sequence (559 amino acids)

>Echvi_2567 Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II (Echinicola vietnamensis KMM 6221, DSM 17526)
MKDFPWFKFYPKSVPQEVDVEAYSSVVGLFEESVQKYGEAVAYECMGKKISFHEVDRLSK
DFASYLQNELKLKKGDRIAIQMPNLLQYPVAMFGALRAGLIVVNTNPLYTPHEMEHQFKD
ADISAVVIVANFASNLEEILPRLDVKHIILTEIGDMLGGLKGGIVNLVVKYIKKMVPAYN
LPNAVKFNDALDIGSHLDLQPVTLDLNDTAYLQYTGGTTGVSKGAALTHGNIIANMQQIS
AWMRPKLKEGEELVITALPMYHIFALTVNCLAMLKIGAHNLLITNPRDMKAFCKDLRKHK
FSVITGVNTLFNGLLNQESFRNLDFSYLKISVGGGMAVQKYVAEKWNAVTGTPLAEGYGL
TETSPVACCNPIDGTERIGTIGLPLPNTEVKIIDDEGNELPNGEKGELCIKGPQVMKGYW
NKPKETNDVMLGEWLKTGDIGIITNDGFIKIVDRKKEMILVSGFNVYPNEVEDAIATHDK
VMEVGVIGMPDEHSTEKVIAYVVANDPSVTASEIIKHCRESLTNYKVPREVYFVDELPKS
NVGKILRRIIKEDHIKKSA