Protein Info for Echvi_2566 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: biotin synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR00433: biotin synthase" amino acids 15 to 312 (298 residues), 406.1 bits, see alignment E=4.3e-126 PF04055: Radical_SAM" amino acids 50 to 210 (161 residues), 84.5 bits, see alignment E=9.8e-28 PF06968: BATS" amino acids 222 to 312 (91 residues), 101.8 bits, see alignment E=1.9e-33

Best Hits

Swiss-Prot: 82% identical to BIOB_CYTH3: Biotin synthase (bioB) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 82% identity to chu:CHU_2466)

MetaCyc: 58% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0H4 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Echvi_2566 biotin synthetase (Echinicola vietnamensis KMM 6221, DSM 17526)
MTEIRNNWTREEIKEIFDSPIMELMYKAATVHREFHDPQEVQVCTLLSVKTGGCPEDCAY
CPQAARYHTDVKVHKLLDVEEVINKATDAKAAGSTRFCMGAAWREVRDNRDFDKVLDMVK
GVNNMGMEVCCTLGMLSEEQAKKLKDAGLYAYNHNLDTSEDHYNEIITTRNYDDRLDTLD
NVRKADISVCSGGIIGLGENLDDRVGMLHTLATLPSHPESVPVNALVPVEGTPLEKQERV
SVWEMVRMIATARIIMPKSMVRLSAGRVRMNTEEQALCFMAGANSIFAGDKLLTTPNPEE
DMDKKLFQTLDLKPRKAFKDQEVGV