Protein Info for Echvi_2564 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): DNA repair nuclease with dnaQ and GIY-YIG domains
Rationale: Specifically important in stress Cisplatin. Contains a domain that is similar to DnaQ (the epsilon subunit of replicative DNA polymerase which is the exonuclease for proofreading) as well as a GIY-YIG nuclease domain.This protein is often misannotated as DnaQ, but the proofreading activity of the replicative DNA polymerase seems to reside in the same polypeptide as the catalytic subunit (see Echvi_2020 or discussion in PMC3919608).
Original annotation: exonuclease, DNA polymerase III, epsilon subunit family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 5 to 176 (172 residues), 96.7 bits, see alignment E=6.9e-32 PF00929: RNase_T" amino acids 5 to 158 (154 residues), 122.3 bits, see alignment E=4.4e-39 PF01541: GIY-YIG" amino acids 200 to 271 (72 residues), 28.1 bits, see alignment E=3.1e-10 PF27096: UvrC_M" amino acids 293 to 374 (82 residues), 62.7 bits, see alignment E=6.1e-21

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 46% identity to mtt:Ftrac_0002)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1B7 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Echvi_2564 DNA repair nuclease with dnaQ and GIY-YIG domains (Echinicola vietnamensis KMM 6221, DSM 17526)
MIYAIVDIETTGGYGKRHRITEVAAVAHNGSQILDSFQTLINPDCEIPGFITGLTGIDQS
MVEGAPYFEDIADELYAFLEDKIFVAHNVNFDYQFIRSEFERIGKSFDRPKLCTVRLSRK
IFPGLRSYSLGRICEHKNIEIKSRHRAFGDAEATAELFTKLLLADQEGIVEQLLKRNSGE
AFLPPNITKEQFLSLPESIGVYYFHDANGKVIYVGKALNIRHRFKGHFSGAGKGKQGMKS
AIYDVSFQLTGSEFLALLVEALEIKQHWPKYNRAQKAKNAPWGIYRYQDGQGFERFQVAK
INRFTKPLLAFHSHHEAWSYLLEKIEKHQLCAKLCGVQKSASACFDHQAGACLGACCGEE
EPSSYNTRVEDWLQEIQREKSRLLIREKGRHPNEQAAIYFEDGVLKAYGFIDSEAEFDTD
EAVIDQLEMVKPVGDTSSILAQYLSKNLMKKVVVLPS