Protein Info for Echvi_2530 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Short chain fatty acids transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 54 to 76 (23 residues), see Phobius details amino acids 97 to 123 (27 residues), see Phobius details amino acids 144 to 154 (11 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 388 to 392 (5 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details PF02667: SCFA_trans" amino acids 10 to 206 (197 residues), 156.7 bits, see alignment E=1.1e-49 amino acids 248 to 432 (185 residues), 174.5 bits, see alignment E=4.1e-55 PF03606: DcuC" amino acids 319 to 429 (111 residues), 28.8 bits, see alignment E=4.8e-11

Best Hits

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G185 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Echvi_2530 Short chain fatty acids transporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKHRLKVSFPTPFGLALLLSACSIFLAVLETRPANEGVAAYTFRVLGYWKEGFWGLLAF
TLQMVLILVFGHVLAVSRPISNALDRITSKVKSNVQAVMLTGGVTMLAGYFNWGFGLIIG
AVLARKMGEMAAKRGVGINYPLVASSGYLGMMVWHGGFSGSAPLKVAESGHFLEEEIGVI
PVNETILSTFNLTLNAILVLAILGLLYGLAKWKKVTPEYPVDQSGQLLPAGNDQLGWWVG
GAICLLAASDLTTVAVSGWGFISLNYINFLLLGLGLVFHKSLKRYVAATGEALKGATGIV
LQFPFYAGILGVLSSSGLLVWIANYFVQVSSPETFPLLAFMSSGLINLFVPSGGGQWAVQ
GPVIVEAAKEMGISVSDMVMVMAYGDEVTNMLQPFWAMPLLAITGISPREMLGYTVCFFL
VGSGVFIIGIYCFLG