Protein Info for Echvi_2526 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 59 to 85 (27 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 241 to 268 (28 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 315 to 341 (27 residues), see Phobius details PF01594: AI-2E_transport" amino acids 9 to 348 (340 residues), 153.4 bits, see alignment E=5.1e-49

Best Hits

KEGG orthology group: None (inferred from 52% identity to mtt:Ftrac_2891)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZN7 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Echvi_2526 Predicted permease (Echinicola vietnamensis KMM 6221, DSM 17526)
MQKLIISVLAFTIFLLLLGWYFSNIAFYLIISLVIAAALRPMTNRINSVHVFGHHIPRWM
AILCSFATIGMVLFLITLLFIPLIIDQIEIIQNVDIEFLYEQIQRPINKVEGFLIKFNLV
SNNPGNLFEQVKETILASVREINFQGFINGLINTTSSLLITILAVVFISFFLLLENGLLR
RNIINLVPNEYFELSVATFHKVERLLSNYLVGLLIQMSAIFTIASTGLAIVGVDYALTIG
VFAAVANLIPYAGPLLGATFGVIVGLITGDFIGTEEMPLFILKILSVFSVVQLTDNLFLQ
PLIFSKSVKAHPLEIFVIIFAGAKVGGVIGMVLAIPVYTIFRVSVQEFYKGYKEYRIFKI
K