Protein Info for Echvi_2522 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ATPase components of ABC transporters with duplicated ATPase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 PF00005: ABC_tran" amino acids 30 to 199 (170 residues), 87.1 bits, see alignment E=5.1e-28 amino acids 350 to 480 (131 residues), 72.7 bits, see alignment E=1.5e-23 PF12848: ABC_tran_Xtn" amino acids 238 to 322 (85 residues), 98.3 bits, see alignment E=6.4e-32 PF16326: ABC_tran_CTD" amino acids 577 to 642 (66 residues), 47.2 bits, see alignment E=6.6e-16

Best Hits

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 65% identity to mtt:Ftrac_1356)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0E0 at UniProt or InterPro

Protein Sequence (652 amino acids)

>Echvi_2522 ATPase components of ABC transporters with duplicated ATPase domains (Echinicola vietnamensis KMM 6221, DSM 17526)
MIYKRENPYFCSMLSINNLSYYIGGRALYENASLHIKPKDKIGLVGLNGTGKSTLLKIIN
GDYQPSKGEIQKSKDCTIGFLNQDLLSYQSDDSILDVALEAFKETLGLQAEIDAVLKQME
TDYSEEIIHKLANLQERFEANEGYTIKAKAEEVLEGIGFATKDLVRPLRTFSGGWRMRVM
LAKLLLEKPSLLMLDEPTNHLDLPSIQWVENYLKTYEGAVIVVSHDQTFLDNCIETTVEV
SRQTLTPYAGNYSFYKEEKVEREEIQQNAYENQQKMIKDTERFIERFRAKASKSNQVQSR
VKALERMERVNEVVSDNISVNFKFKFSKQSGRDVVTLDQVSKAYGDITILDNTSARIERG
DKIALIGANGKGKSTLLRIIDGSEKIDGQRQEGYNVVKSFFAQHQLEALNVNNEILQEMV
QAGSDKTETELRNVLGCFLFTNDDVFKKIKVLSGGEKSRVALAKTLISEANFLLLDEPTN
HLDMQSVNILIQALEQYEGTFITVSHDRHFIKGVANKIWYIEDHEIKEYPGTYDEYMLWR
SQQDEKTDAPAVKKEKVTKPKPVRNDGEVNQAKKDLKKKERELEEIEDSIMKLEEEKAGL
EKQLADPAVFQDEEQSQKVNKAYEELRGKEQSLTAQWEQIAEEIQELQEVVS