Protein Info for Echvi_2515 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00007.
Original annotation: phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00977: His_biosynth
  • amino acids 2 to 229 (228 residues), 250 bits, E=1e-78
• TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
  • amino acids 3 to 233 (231 residues), 250.6 bits, E=7.3e-79

Best Hits

Swiss-Prot: 63% identical to HIS4_CYTH3: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 63% identity to lby:Lbys_2915)

MetaCyc: 36% identical to 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (Escherichia coli K-12 substr. MG1655)
isomerase. [EC: 5.3.1.16]

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.16

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

See L0G169 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Echvi_2515 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Echinicola vietnamensis KMM 6221, DSM 17526)
MEIIPAIDIIGGKCVRLTQGDYGQKKEYADNPLEVAKKFEGAGIKRLHLVDLDGAKAKTI
VNRAVLENITSHTSLKVDFGGGVQSDETIQMAFDAGASQVTGGSIAVKNPALFEGWLEKH
GSEKIILGADAKNRKIAISGWEETTEADVVDFIKDYHAKGARYVICTDVAKDGLLQGPSV
DLYREIIQEIPGIRLIASGGVAEVRDLEVLEKIGVFGTIVGKAFYEGRVSLEELATFAD