Protein Info for Echvi_2514 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07685: GATase_3
  • amino acids 3 to 102 (100 residues), 29.1 bits, E=1.2e-10
• TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  • amino acids 3 to 193 (191 residues), 201.7 bits, E=5.5e-64
• PF01174: SNO
  • amino acids 11 to 104 (94 residues), 28.3 bits, E=2.3e-10
• PF00117: GATase
  • amino acids 19 to 192 (174 residues), 67.6 bits, E=1.8e-22

Best Hits

Swiss-Prot: 53% identical to HIS5_BACTN: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 62% identity to chu:CHU_1271)

MetaCyc: 42% identical to imidazole glycerol phosphate synthase subunit HisH (Escherichia coli K-12 substr. MG1655)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 4.3.2.10

Sequence Analysis Tools

See L0G1N0 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Echvi_2514 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MDVAIIKYNSGNVLSVLYALERLGINANLTDDVEEIKKADKVIFPGQGEASSAMRYLRER
NLDQLIKDLKQPFFGICLGQQLLCEYSEENDTECLGVFPVKVRKFPPADKVPHVGWNSLQ
ETQGQLLEGINTHDYVYYVHSYFAEIHPEFTVAKTHYIEDFSALLQKDNFYAMQAHPEKS
SHSGQKILTNFLKL