Protein Info for Echvi_2512 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phospho-2-dehydro-3-deoxyheptonate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 TIGR01361: 3-deoxy-7-phosphoheptulonate synthase" amino acids 70 to 327 (258 residues), 338.8 bits, see alignment E=1e-105 PF00793: DAHP_synth_1" amino acids 88 to 331 (244 residues), 248.9 bits, see alignment E=4.4e-78 PF03102: NeuB" amino acids 150 to 331 (182 residues), 31.6 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 48% identical to AROF_THEMA: Phospho-2-dehydro-3-deoxyheptonate aldolase (aroF) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K03856, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 67% identity to mtt:Ftrac_1037)

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I beta (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0D3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Echvi_2512 phospho-2-dehydro-3-deoxyheptonate aldolase (Echinicola vietnamensis KMM 6221, DSM 17526)
MIIQVKQDITEVQKERLIKEINQIGYKITEVITQKGTYLVGIGSAEFDIRKFGHHEGIQD
IHIVSDAYKLVSRKWKVNPTSIDLGDGVYIKEGDMAVMAGPCSIESEEQIVKVIDHLKAN
NIKIMRGGVYKPRSSPYAFRGLGIEGLKLWHELASKAGIKIITEVMQVSQIEEMMDYVDV
FQVGARNTQNFNLLDELGKVDKPVMIKRGISGTIEELLQSAEYVFSGGNEKLILCERGIR
TYEKATRNTLDLNAVPVLKDKSHLPVVVDPSHGIGIRKFVHQMALAGVMAGADGIIYETH
EIPEKAYSDGQQTLDFAQSSQLASQIRKTFAMRKTFDLL