Protein Info for Echvi_2498 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted ATPase involved in cell division

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 116.3 bits, see alignment E=1.7e-37

Best Hits

Swiss-Prot: 36% identical to GLTL_ECOLI: Glutamate/aspartate import ATP-binding protein GltL (gltL) from Escherichia coli (strain K12)

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 67% identity to mtt:Ftrac_1409)

MetaCyc: 36% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1L6 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Echvi_2498 Predicted ATPase involved in cell division (Echinicola vietnamensis KMM 6221, DSM 17526)
MVFSSEPVVRLDKACIFQGITAILQDVTFDIEKDEFVFLIGRTGSGKSSLLKTLYADLPL
KMGYGKISGYDLKEIKTKDVPFLRRKLGIVFQDFQLFTDRTVAENLYFVMRATGWKDKAK
MKTRMVEVLMRVGLGGAATKMPHQLSGGEQQRVVIARALLNHPSILLADEPTGNLDPEVA
DGIFKLFQEINKQGTAVLMATHNHDLLNKYPYRILKCEKGKLLDSKTTEIIK