Protein Info for Echvi_2496 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 7TM diverse intracellular signalling./7TMR-DISM extracellular 2.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 183 to 205 (23 residues), see Phobius details amino acids 214 to 238 (25 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 37 to 169 (133 residues), 101.3 bits, see alignment E=6.4e-33 PF07695: 7TMR-DISM_7TM" amino acids 182 to 384 (203 residues), 156.7 bits, see alignment E=1.2e-49 PF12760: Zn_ribbon_IS1595" amino acids 490 to 534 (45 residues), 32.5 bits, see alignment 1.1e-11

Best Hits

KEGG orthology group: None (inferred from 50% identity to mtt:Ftrac_1806)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0C2 at UniProt or InterPro

Protein Sequence (618 amino acids)

>Echvi_2496 7TM diverse intracellular signalling./7TMR-DISM extracellular 2. (Echinicola vietnamensis KMM 6221, DSM 17526)
MWFMMMNTQVTQAQRISGSSTLKIDDNLDERIFSIGQLEFFEDTTNALVFDDIIQPDFQE
NFKIRPSFNKNKFDINHTYWVKLSIDKTPESSKKWLMEFYDQTIDVVEVYAPDGEGGFEE
IIMGDAIPFDSRNFSHKNFELFIHNNSEGISNYYVKIQSHQKADIRIAIRSVNRFIYYAL
NEYFAYGVFYGMILIIGLYNLLVYTVIREIKYLYYTFYLISVGIYALSVDGIAFQYLWPN
FPKWNQIANGVFSYSIVLWAILFSIKFLNTRFRSPKIHQALIVILIIKSIIFLIGLFWDP
KLFEIKYYDIIPFFFIFIASVYIWSRGYKVARFFVIAYGVLFIGVVVKVLVNAAIIPHMT
LVYYSLHLAFLVEMLLLTFALGDRIQILKDNRDRAMRRTIRQMEDNFALKEKVNKELELK
VSERTKELAHKNKLLEDYNQQLTEKDEEIKRINSLLDRDNWKLKSSIKESFQARLSNKLL
SFEEFQRIFPDQSACLRYLEEFKWGQGYECRHCGNTKSSKGPKLFTRRCSKCGHIDSVTA
GTIFHGVKFPLEKAFYIAYELIANTEKRTLEQLAELLDLRKNTVWNFRKKTRQNIEAHNI
EHPHWDDILLIMPKGEFR