Protein Info for Echvi_2485 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: AraC-type DNA-binding domain-containing proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 30 to 52 (23 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details PF12833: HTH_18" amino acids 277 to 356 (80 residues), 61.8 bits, see alignment E=6.2e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZJ9 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Echvi_2485 AraC-type DNA-binding domain-containing proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MGIMLTVVILQALTSGLLIYLNKRYKGEDLYLSLLFGIIAIHVSYKALLYWLVDDMEVFD
KLHGCFSLLYGPLLYFYVQSIRNRPISSAQIIVHASPFFIGFGLNIMMVMLLMIQETSAL
IMELYHQGVIISVFVSFSAYSLYSLYLLHHTSNNNAIYRQKATIARLIAACNLLLSFLVV
FGWVMLIWDVQFPVSTRYIYYFLMLALFYSIIHIRTRMLLHAKPSETTFPKISIQAQEKY
RNSKVSEEELATILDQINKVFKDKKPYLNPDFNLDQLAKELDTTKLKITQALNLHLGQNF
YQYVNSARIEESKNLLQQPNEDNLTVVGYESGFKSKSTFYKYFKEATGCSPSDYKKSLQV
NG