Protein Info for Echvi_2481 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: fumarylacetoacetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 TIGR01266: fumarylacetoacetase" amino acids 11 to 421 (411 residues), 585.8 bits, see alignment E=2.5e-180 PF09298: FAA_hydrolase_N" amino acids 25 to 125 (101 residues), 97.2 bits, see alignment E=6e-32 PF01557: FAA_hydrolase" amino acids 132 to 400 (269 residues), 124.2 bits, see alignment E=6.4e-40

Best Hits

Swiss-Prot: 49% identical to FAH_ARATH: Fumarylacetoacetase (FAH) from Arabidopsis thaliana

KEGG orthology group: K01555, fumarylacetoacetase [EC: 3.7.1.2] (inferred from 63% identity to mtt:Ftrac_0820)

MetaCyc: 54% identical to Fumarylacetoacetase (Homo sapiens)
Fumarylacetoacetase. [EC: 3.7.1.2]

Predicted SEED Role

"Fumarylacetoacetase (EC 3.7.1.2)" in subsystem Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 3.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0A7 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Echvi_2481 fumarylacetoacetase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKEQKVKPLKSWVQIPKNSDFTIYNLPFGVFRNKRLSPRIGMAIGDKIVDLHVLFCEGFF
SSIHLPEEVFLKDSLNEFMALGKPMTRKVREMVQELLLEENTALKDHRARGKVMVNRKEA
KMLMPVKVGDYTDFYSSKEHATNVGTMFRDPENALMPNWKHLPVGYHGRASSIVPSGTPI
HRPKGQFKAPDAEKPSFGPSRRLDFELEMAFITSNPTKMGTSIRTQEAEEHIFGFVLFND
WSARDIQAWEYVPLGPFLGKSFASSISPWVVTLEALAPFRTKSPKPEEPLLPYLQCEQDH
GFDIHLEVGIQPEGKQETIVCRSNYKYLYWNIAQQLAHQTVNGCNINVGDMYASGTISGP
EESSFGSMLELAWKGTKPIRLDCGAERSFIEDGDTVTMRGYAEKDGVRVGFGEVSTAVMP
SNGKG