Protein Info for Echvi_2479 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF03807: F420_oxidored" amino acids 5 to 99 (95 residues), 63 bits, see alignment E=6.6e-21 PF02558: ApbA" amino acids 6 to 117 (112 residues), 27.6 bits, see alignment E=4.2e-10 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 6 to 263 (258 residues), 230.9 bits, see alignment E=1e-72 PF14748: P5CR_dimer" amino acids 162 to 264 (103 residues), 107.9 bits, see alignment E=6e-35

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 53% identity to cpi:Cpin_0657)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.2

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G132 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Echvi_2479 pyrroline-5-carboxylate reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNLKIAIIGCGNLGLSIVNGLLETEGFEAKNLMVTKRHPENLSHLQSLGVTVTADNKSA
AKAADLVILGVKPYNIPHILKEIAPVVSPDKQTIISLATGVTLEEMYQHLPSTTALYRAM
PNIAADIQESITCICGQNSTPENEDIIKALFNSIGISIIIEEHLMEAATVLGACGIAYVL
RFMRAMTQGGIQIGFDAKTANTIVNQTVKGAAELLIKKGIHPEAAIDKVTTPKGCTIVGL
NEMEHHGFSAAMVKGVLASYEKIEK