Protein Info for Echvi_2475 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted amino acid aldolase or racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01168: Ala_racemase_N" amino acids 20 to 197 (178 residues), 29 bits, see alignment E=8.9e-11 PF14031: D-ser_dehydrat" amino acids 254 to 354 (101 residues), 48.9 bits, see alignment E=8.3e-17

Best Hits

KEGG orthology group: None (inferred from 40% identity to mtt:Ftrac_0721)

Predicted SEED Role

"D-serine dehydratase (EC 4.3.1.18)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZI9 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Echvi_2475 Predicted amino acid aldolase or racemase (Echinicola vietnamensis KMM 6221, DSM 17526)
MPLLPAITSPTLLVHEAVCKANIARMSDKGRKHRLNLIPHFKTHQSRAIGNWYKEYGIEE
ITVSSLHMAEYFVGQSWKNIHIAFPFNPLEIDLLEQLTLQSSISIQLVNAQVTQLLADRL
QNPVEFFIEIDAGYGRAGIEVSDFGAIEAIMRIANRSDKLNFKGFYIHAGHTYHADPAGI
HRIHEQTKSALKMLKDKYFDEFPSLKTRIGDTPSCSLESDFDGVDEIGPGNFVFYDLTQV
HIGSCNKSDIGIALAAPVVDIKKTKHEILIHGGGVHLAKDVLTYPDGSQNFGELVVFNGQ
GWDIPETPSFLKSISQEHGLVNATDELLSKVKVGDIIGILPVHSCMTADCMRGFLGLSGE
KLDHFKGQQKLQ