Protein Info for Echvi_2471 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 13 to 484 (472 residues), 264.7 bits, see alignment E=7.9e-83 PF02321: OEP" amino acids 70 to 273 (204 residues), 91.8 bits, see alignment E=2.5e-30 amino acids 303 to 482 (180 residues), 73.7 bits, see alignment E=8.6e-25

Best Hits

KEGG orthology group: None (inferred from 59% identity to zpr:ZPR_4344)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G097 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Echvi_2471 efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family (Echinicola vietnamensis KMM 6221, DSM 17526)
MNSLKNILPFTLVVIAMASCKVGQNYNRPEIDFPDQYYGADSLRDSLMTGKKNMAAVNWK
AYFKDSTLVSLIDSALSNNFDMQKMTKEIDIGYQNLQQSKANFLPSLGASPFKYNREYYS
EYYNNYGSNRARRNHGEDIPTSLYTERMEYVSSLQASWEIDIWGKLRWQKEAARADFMKT
QEFKKALQTALVSEVATTYLNMLMLKSQLTVSRRNYELSKNTLRIVKLQYDAGETTSLAV
QQTESQMLRAKALIPDLERDYAIQETRLNELLGRAPQELELVHHLEDIAFDSTYQTGVPL
ELIQNRPDIAASEYNLIISNANVGVTQAMKYPSLTISGGVGLNSYQIEHFLDPMGAGFAL
LNGAIFQPIFQNRKLKTNHLIALNKREIAQLDFKETIIGAVGEVSNALVTIEKLQEAHNI
VEDRLQVTNKGIKDAFLLFQSGFASYLEIINAQEDALENQMELVRLKTQLAIANIELYRS
LGGGWK