Protein Info for Echvi_2468 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Arginase/agmatinase/formimionoglutamate hydrolase, arginase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00491: Arginase
  • amino acids 14 to 307 (294 residues), 191.6 bits, E=1e-60

Best Hits

KEGG orthology group: K01476, arginase [EC: 3.5.3.1] (inferred from 52% identity to nve:NEMVE_v1g224716)

Predicted SEED Role

"Arginase (EC 3.5.3.1)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.1)

MetaCyc Pathways

• L-citrulline biosynthesis (8/8 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-arginine degradation VI (arginase 2 pathway) (4/4 steps found)
• L-N^δ-acetylornithine biosynthesis (6/7 steps found)
• L-arginine degradation I (arginase pathway) (3/3 steps found)
• urea cycle (4/5 steps found)
• superpathway of putrescine biosynthesis (3/4 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• L-arginine degradation VII (arginase 3 pathway) (1/2 steps found)
• L-canavanine degradation I (1/2 steps found)
• putrescine biosynthesis III (1/2 steps found)
• superpathway of polyamine biosynthesis I (3/8 steps found)
• superpathway of polyamine biosynthesis II (2/8 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.1

Sequence Analysis Tools

See L0G1I5 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Echvi_2468 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family (Echinicola vietnamensis KMM 6221, DSM 17526)
MRNIKLVEVRSELAAGTRGASLGIDALKVASLGKKSDFFTRFDPINVPDANNYLWKNNPY
PHAKYIDGVHEVLGNVHDTIKALREEKKFPIVLAGDHSTAAGTIMGIKAANPEKRLGVIW
IDAHADIHSPYTSPSGNMHGMPLGMCLQEDNLENRQQDPSAEEIEYWEKIKKIGGDFPKI
KASDIVYIAVRDTEEPENKLIEKHGIRNFTTQEVRQKGITQISEEALAILKDCEQIYISF
DVDSMDSSISVGTGTPVPDGLTVQEALKLNMELIKDKRVCCWEIVEVNPTLDSENIMAQN
AFEVLESTTKSLVSNF