Protein Info for Echvi_2454 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Tetratricopeptide repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13432: TPR_16" amino acids 21 to 82 (62 residues), 24.6 bits, see alignment E=1.7e-08 amino acids 56 to 117 (62 residues), 27.9 bits, see alignment E=1.6e-09 PF07719: TPR_2" amino acids 51 to 83 (33 residues), 24.7 bits, see alignment 1e-08 amino acids 187 to 219 (33 residues), 25.7 bits, see alignment 4.8e-09 PF13181: TPR_8" amino acids 51 to 82 (32 residues), 16.8 bits, see alignment 3.7e-06 amino acids 86 to 116 (31 residues), 13.2 bits, see alignment 5e-05 amino acids 187 to 218 (32 residues), 13.9 bits, see alignment 3e-05 PF13414: TPR_11" amino acids 63 to 98 (36 residues), 28.9 bits, see alignment 4.4e-10 PF00515: TPR_1" amino acids 187 to 219 (33 residues), 30 bits, see alignment 1.9e-10 PF13174: TPR_6" amino acids 188 to 219 (32 residues), 15.4 bits, see alignment 1.4e-05

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G113 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Echvi_2454 Tetratricopeptide repeat. (Echinicola vietnamensis KMM 6221, DSM 17526)
MRLLLACTCMLMFSACGGDFNQARGYFENQQFEKAISELDWVLFMKMSDVEALQLRAMSH
EALEEYEEALTDYKRILQLKPRDGNAYAGIGKLYWEKGAYKLAEQHLLLAAKEKPEDVDL
LILLGRAMIKNEHYQSADEFLKSAREIEPKNAAIYFYRGIVQANLGDPWTTAAQFNMYIM
YAPDNLKAYYNRGFAYMRMGMTEWAKEDFDYVVEKNPNHYEALARRAMCMIDFNPSQACL
DLQKAAQNGSDYAKENLDLCR