Protein Info for Echvi_2451 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF07075: NamZ_N" amino acids 64 to 264 (201 residues), 274.2 bits, see alignment E=5.2e-86 PF20732: NamZ_C" amino acids 270 to 406 (137 residues), 117 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: None (inferred from 60% identity to bth:BT_2135)

Predicted SEED Role

"alternate gene name: yzbB" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G080 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Echvi_2451 Uncharacterized protein conserved in bacteria (Echinicola vietnamensis KMM 6221, DSM 17526)
MQINMKQLKLILLLIFLPTFLGCRAISGSLLAKTTTDDPSTSSPILPGADQPEQYLPLLR
GKKVGLVANQTSVLTQKNNQHLVDFLLENDIAVQKIFVPEHGFRGNADAGEVIKNDTDKE
TGIPLVSLYGSNKKPSEEALMDIDILIFDFQDVGLRFYTYISTMHYVMEACAEQGKPLII
LDRPNPNGDYIDGPVLDPAYQSFVGMHPIPVVHGLTMGELALMINGEGWLKHQVKADITV
IPVANWNHEQHYSLPVKPSPNLPNDVSIRLYPSLCFFEGTDISVGRGTYFPFQVYGAPDP
KYGSFTFTPESINGMSKHPPHEGKTCYGTDLRKTPLTHQFTLQYLLEMYQKSGGGQQFFN
SFFDKLAGTDQLRKDILAGKSAAEIKAGWQKPLQAYKTMREKYLLYP