Protein Info for Echvi_2450 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR00460: methionyl-tRNA formyltransferase" amino acids 5 to 304 (300 residues), 275.5 bits, see alignment E=2.8e-86 PF00551: Formyl_trans_N" amino acids 6 to 182 (177 residues), 129.7 bits, see alignment E=1.1e-41 PF02911: Formyl_trans_C" amino acids 207 to 304 (98 residues), 102 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 55% identical to FMT_BACFR: Methionyl-tRNA formyltransferase (fmt) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 69% identity to dfe:Dfer_4814)

MetaCyc: 39% identical to 10-formyltetrahydrofolate:L-methionyl-tRNAfMet N-formyltransferase (Escherichia coli K-12 substr. MG1655)
Methionyl-tRNA formyltransferase. [EC: 2.1.2.9]; 2.1.2.9 [EC: 2.1.2.9]

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZG5 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Echvi_2450 methionyl-tRNA formyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKDLRIIYMGTPDFAVPSLEILVENGWNVVAVITAPDKPKGRGQKLIPSPVKAAALKHE
IPVLQPTNLKSPEFIEELKGYRADVQVVVAFRMLPEVVWNMPPRGTFNLHASLLPDYRGA
APINWAIINGEEETGVTTFFLKHEIDTGSIIYQEKEPILPQDNIGSLYEKLMARGSKLVL
KTIEAIDKGDVDTYGQDEAKALHHAPKIFKETCEIDWSKPARSIHNLVRGLSPYPAAWTT
LQDKSCKIFATEIVDELKGKSPGEYASDNKTYLHFQTGAGALSIKELQLQGKKRMEIQDF
LRGNKL