Protein Info for Echvi_2447 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: competence/damage-inducible protein CinA C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR00177: molybdenum cofactor synthesis domain" amino acids 4 to 169 (166 residues), 94.9 bits, see alignment E=6.6e-31 TIGR00200: competence/damage-inducible protein CinA N-terminal domain" amino acids 5 to 412 (408 residues), 333.7 bits, see alignment E=2.1e-103 PF00994: MoCF_biosynth" amino acids 7 to 172 (166 residues), 118.3 bits, see alignment E=3.4e-38 PF18146: CinA_KH" amino acids 182 to 256 (75 residues), 67.2 bits, see alignment E=1.7e-22 PF02464: CinA" amino acids 260 to 412 (153 residues), 181.7 bits, see alignment E=1.1e-57 TIGR00199: amidohydrolase, PncC family" amino acids 270 to 408 (139 residues), 141.7 bits, see alignment E=2.8e-45

Best Hits

Swiss-Prot: 50% identical to CINAL_CYTH3: CinA-like protein (CHU_2526) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03742, competence/damage-inducible protein CinA (inferred from 53% identity to mtt:Ftrac_0526)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXQ4 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Echvi_2447 competence/damage-inducible protein CinA C-terminal domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MKQITAEIIAIGDELLYGQIMDTNSHWISKELDQIGVRVVRKTTVGDNEPDILHAFRHAQ
NRANIILITGGLGPTKDDLTKPLLAKYFECSIEPFPEAIADVKAFFEKRGRELTPLNKLQ
GHLPTKCQYVKNDRGTAPGMWFEENGCVWMSMPGVPHEMQFLMENFVLPKIKTLFSLPVI
YHKVIKTAGIGESWLADMIAEWEDQLPSHIKLAYLPSLGEVKLRLTAFGDDINQLQEEVN
QYIQQVKPLIKNYIYGYDQETIAEAIGRILTLNKKTISIAESCTGGYVSHLVTAIPGSSN
YFNGAITPYHNQFKTALLGVKESTLMAHGAVSEETVMEMASMVRKKFDADYGLATSGIAG
PGGGSPEKPVGTVWIAIANREGVKTKKLQLAHDRLLNIQYSALTVLNLLRKVIKNEND