Protein Info for Echvi_2437 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF19335: HMBD" amino acids 36 to 62 (27 residues), 50.7 bits, see alignment (E = 3.4e-17) PF16576: HlyD_D23" amino acids 102 to 311 (210 residues), 236.3 bits, see alignment E=6.1e-74 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 169 to 390 (222 residues), 129.7 bits, see alignment E=6.1e-42 PF13437: HlyD_3" amino acids 208 to 308 (101 residues), 53.3 bits, see alignment E=1.1e-17 PF11827: DUF3347" amino acids 424 to 510 (87 residues), 50.3 bits, see alignment E=9e-17

Best Hits

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXP6 at UniProt or InterPro

Protein Sequence (575 amino acids)

>Echvi_2437 RND family efflux transporter, MFP subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MFLGAFLAGGIIGGVLTSGEGAKEALDQHDHKGETVYTCSMHPQIKQNEPGDCPICGMDL
VPLSTLGDSEDTNPYVMTMSPEAVALANIATSTVKAGSEMASNHLTLSGTIEVDERNVKS
VSANFDGRIDDLYVAFTGQEVKQGQRLARIYSPDLIAAHRELLEAKKATGISPKLYEAAK
QKLKQWQLTDAQITKMANDEDYQPHFDIYAATSGVVTDRKVAAGDYVSRGQVLFEITNLN
KVWVMLDAYEQGLGQISAGDQIQFSVNALPGEEFSAKVAFIDPVVSADSRSAKVRAEVNN
FSGKLKPGMFVTAKLSTQDEAPVDAGVMVPKSSILWTGRRSVVYRQVGSEMKPAFEMVQV
ELGPVAGEMQQVLTGLSPGDQIVTNGVFAVDGAAQLSGKYSMMAHPEEQDFQVSESFGKV
IEEVIAAYLTMKNRLVRDESGQAAAGNLHKLLTEENPPLSQEKALEKWKEISESLAANAL
AMSQTSDIAKQREWLVPVSNEMIKLLDAFGGQGKKLFKDYCPMAKNDQGAYWLSEFEEIK
NPYFGASMLSCGEIKKVYPSQGSHQQKSGHSGHQH