Protein Info for Echvi_2431 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF00106: adh_short" amino acids 16 to 205 (190 residues), 135.5 bits, see alignment E=2.6e-43 PF08659: KR" amino acids 18 to 135 (118 residues), 41.4 bits, see alignment E=2.2e-14 PF13561: adh_short_C2" amino acids 25 to 260 (236 residues), 162.9 bits, see alignment E=1.5e-51

Best Hits

Swiss-Prot: 48% identical to DECR_RAT: 2,4-dienoyl-CoA reductase, mitochondrial (Decr1) from Rattus norvegicus

KEGG orthology group: None (inferred from 73% identity to fjo:Fjoh_0010)

Predicted SEED Role

"2,4-dienoyl-CoA reductase, mitochondrial precursor (EC 1.3.1.34)" (EC 1.3.1.34)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G062 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Echvi_2431 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Echinicola vietnamensis KMM 6221, DSM 17526)
MSYLEGMLKSDALKGKNILITGGGTGLGRSMGKYFLELGANLVITSRKLDVLQHTAKELM
AEVGRGKVIPLACDVRDVDQVEGMFEEAVMQLGQIDVVVNNAAGNFISPTERLSANAFHT
VIDIVLKGSVNMTMTAGKHWIDKKQPGTFLNVVTTYAWTGSGYVVPSATAKAGVLAMTRS
LAVEWAKYGLRFNAIAPGPFPTEGAWSRLLPGELAAQFDPAKRIPLKRVGEHQELANLAA
YLVSDFSAYVNGEVMTIDGGEWLKGAGQFSHLEQIPEKLWDQMEAMRKKKK