Protein Info for Echvi_2428 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: iojap-like ribosome-associated protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 36% identical to IOJAP_HAEIN: Ribosomal silencing factor RsfS (rsfS) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K09710, ribosome-associated protein (inferred from 59% identity to sli:Slin_3002)Predicted SEED Role
"Iojap protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0G1E7 at UniProt or InterPro
Protein Sequence (115 amino acids)
>Echvi_2428 iojap-like ribosome-associated protein (Echinicola vietnamensis KMM 6221, DSM 17526) MTAEELSKIIVKGMEDKKASDIVVMDLREINNSVSDFFVICSGSSDKQIEAISDAVEEEV YKSHKEKPWRNEGKRTNQWVLVDYIDVVAHIFLKDKREFYGLEELWGDAKITEIS