Protein Info for Echvi_2427 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ATP-dependent metalloprotease FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details PF06480: FtsH_ext" amino acids 22 to 111 (90 residues), 28.8 bits, see alignment E=3e-10 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 149 to 633 (485 residues), 729.3 bits, see alignment E=1.1e-223 PF00004: AAA" amino acids 235 to 367 (133 residues), 156.3 bits, see alignment E=1.4e-49 PF07728: AAA_5" amino acids 235 to 354 (120 residues), 23.5 bits, see alignment E=1.2e-08 PF17862: AAA_lid_3" amino acids 390 to 433 (44 residues), 54.2 bits, see alignment 2e-18 PF01434: Peptidase_M41" amino acids 449 to 632 (184 residues), 223.3 bits, see alignment E=6.3e-70

Best Hits

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 76% identity to mtt:Ftrac_1834)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXN7 at UniProt or InterPro

Protein Sequence (681 amino acids)

>Echvi_2427 ATP-dependent metalloprotease FtsH (Echinicola vietnamensis KMM 6221, DSM 17526)
MSDKNKNKKFIPKPPQKPNFQLWLIVTAVIVLIGITWFNQRSAMIEITQKRFEDMVLSND
VKKVEVIYNQNYVEVTLKEDALQNQRYKDELESQNPFFNPTGPHYRVTVPSVDNFIEKFE
ALEAKLPEEDQIGYEAHAEESWGNWFGSFGFLLLVFFLFWIMMRRMAGPSGPGGQIFNVG
KSKAQLFDAENKVKITFGNVAGLDEAKEEVQEIVEFLKNPSKFTKLGGKIPKGALLVGPP
GTGKTLLAKAVAGEAGVPFFTLSGSDFVEMFVGVGAARVRDLFKQAKEKAPCIIFIDEID
AIGRSRGKGQMPGSNDERENTLNSLLVEMDGFGTDTGVIVLAATNRPDVLDSALLRPGRF
DRQISIDKPDIVGREAIFKVHLAPIKTNSDIDPKKLAAQTPGFAGAEIANVCNEAALIAA
RRNKAAVDMQDFQDAVDRVIGGLEKKNKIISPEEKQIVAYHEAGHAVAGWFLEHADPLVK
VSIVPRGIAALGYAQYLPKEQFLYQTEQLIDEMCMTLGGRAAEEIIFGKISTGALSDLER
VTKMAYSIVSVYGMNDKIGNVSFYDSKGSEYKFDKPYSESTAETIDEEVRKLITFAYDRT
KQLLNQRKPELEKLAQELLEKEIIFQSDLEKLIGKRPFDKETTYEAFTKKVDKVEKDAEK
SSDSSDDDSSDVEESLSEKKD