Protein Info for Echvi_2421 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 341 to 445 (105 residues), 83.1 bits, see alignment E=2e-27 PF14501: HATPase_c_5" amino acids 347 to 433 (87 residues), 24 bits, see alignment E=2.9e-09

Best Hits

KEGG orthology group: None (inferred from 39% identity to cpi:Cpin_0952)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G052 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Echvi_2421 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. (Echinicola vietnamensis KMM 6221, DSM 17526)
MDYKIGLLGRVALLTLSLFILSYAILNSSGVFITSLFIILVIAQLIFLVNYAESSFKKVR
QFLDNIKQNNYATVYPVKFDGTETDDLHIEFNAILAKLKEDQAEKEANYQYFRSVFQHLS
IGLITFEEDGRIQILNTAAKRMLNIDHLDNIQEIDQVNKELHNAIQTLRTGGSELIKIAH
QDGIMQLSVYVIELVLRGVKFKLVSLQNIQSELEEKEMEAWQNLVRVLTHEIMNSIAPIS
SLASTIKGDIQSQVERDQPVPVAEVEDYLMGISTIEKRSEGLIDFVSDFRSLAHIPVPKF
SAIRLQELFDQLAVLFQHQIEQYDISCEKKIEPKDLLLFADSSLIEQVLINIIQNAIHAV
EEATIKKISLHAFIDEAGKIIIEISDSGKGIEEDALNKIFIPFFTTKKKGSGIGLSLSKQ
IMRRHKGNIQVKSTVGKGTTFKLIFNA