Protein Info for Echvi_2400 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: CTP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 5 to 531 (527 residues), 798.2 bits, E=1.7e-244
• PF06418: CTP_synth_N
  • amino acids 6 to 270 (265 residues), 421.9 bits, E=1.5e-130
• PF00117: GATase
  • amino acids 306 to 530 (225 residues), 138.9 bits, E=2.5e-44
• PF07722: Peptidase_C26
  • amino acids 371 to 513 (143 residues), 29.3 bits, E=1.1e-10

Best Hits

Swiss-Prot: 74% identical to PYRG_CYTH3: CTP synthase (pyrG) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 74% identity to chu:CHU_2536)

MetaCyc: 57% identical to CTP synthetase (Bacillus subtilis subtilis 168)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See L0G033 at UniProt or InterPro

Protein Sequence (540 amino acids)

>Echvi_2400 CTP synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MASPTKYIFITGGVTSSLGKGIIAASLAKLLQSRGFKVTIQKFDPYLNIDPGTLNPYEHG
ECFVTEDGAETDLDLGHYERFLNTNTSQDNNVTTGRIYNNVITKERKGEFLGKTVQVIPH
ITDEIKNSFYKLGEEGNYDVVITEIGGCVGDIESLPFIEAVRQARWDLGPNNFLVVHLTL
IPYLSAAKELKTKPTQHSVKQLLEAGIQPDILVCRSEHHLPLDVKKKLALFCNVQLNCVI
EAMDAETIYDVPLHMKKEKLDERVMTKLKLPSKSDTKLELWKEFLGRLKNPTQEVNIGLI
GKYISLPDAYKSIIESFTHGGAACETKVNLSLISSEEIEKENVAKKLAELDGILVAPGFG
ERGLEGKLETVKFARTNKIPFFGICLGMQVAVIEFARNVLGLADANSIEMNPETPHPVIS
LMEEQKNVEQMGGTMRLGSYPCELTKGTKVSAAYGKAKIQERHRHRYEFNNDYLTQYKEK
GMVPTGINPESGLVEIVELKDHPWFVGTQFHPEYKSTVLNPHPLFVRFIQATLDNKKNNN