Protein Info for Echvi_2397 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ParB-like partition proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 43 to 216 (174 residues), 190.4 bits, see alignment E=1.3e-60 PF02195: ParBc" amino acids 47 to 136 (90 residues), 99.4 bits, see alignment E=1e-32 PF17762: HTH_ParB" amino acids 186 to 236 (51 residues), 65 bits, see alignment 4.3e-22

Best Hits

Swiss-Prot: 44% identical to SP0J_BACSU: Stage 0 sporulation protein J (spo0J) from Bacillus subtilis (strain 168)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 66% identity to mtt:Ftrac_3754)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1C4 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Echvi_2397 ParB-like partition proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MADNKKTTTNKKKALGRGLGALLQDSPNKEPKDEVQEQARPEAGIYEIPLDEIQVNPYQP
RTHFDKDALQELADSITVQGIIQPITVRKLSDNEYQLISGERRFQASKLAGLTMVPAYVR
TANDQQMLEMALIENIQRENLNALEIAHSYQRLLSECELKQEQLGDRVGKNRTTVNNYLR
LLKLPPDIQAGIRDKKISMGHARALINVEDVDKQLAIYRKTLEEELSVRKVEALVKALHE
DGEEEKTISNKPDLDPVKKYELGKLQQKLASHLGTKVSLKMDHKDKGEIKIPFGSTDDLN
RILEILEII