Protein Info for Echvi_2388 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosomal protein S6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 TIGR00166: ribosomal protein bS6" amino acids 4 to 93 (90 residues), 73.5 bits, see alignment E=6.5e-25 PF01250: Ribosomal_S6" amino acids 5 to 93 (89 residues), 102 bits, see alignment E=8.5e-34

Best Hits

Swiss-Prot: 66% identical to RS6_BACTN: 30S ribosomal protein S6 (rpsF) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02990, small subunit ribosomal protein S6 (inferred from 70% identity to mtt:Ftrac_0280)

Predicted SEED Role

"SSU ribosomal protein S6p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0W2 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Echvi_2388 ribosomal protein S6 (Echinicola vietnamensis KMM 6221, DSM 17526)
MFQRNYETVFILTPVLSDVQMKDTVDKFVNLLKEEGAEIINVENWGLKKLAYPIEKKSTG
FYVMVEFKSLPTLIKKFEIEIRRDEKVMRFLTTVLDKHAIAYAERRRKGEFNKKTETKEE
AAK