Protein Info for Echvi_2380 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 6-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00365: PFK
  • amino acids 8 to 283 (276 residues), 366.1 bits, E=6e-114
• TIGR02482: 6-phosphofructokinase
  • amino acids 8 to 308 (301 residues), 424 bits, E=1.3e-131

Best Hits

Swiss-Prot: 55% identical to PFKA2_BACTN: ATP-dependent 6-phosphofructokinase 2 (pfkA2) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 61% identity to wvi:Weevi_1531)

MetaCyc: 53% identical to 6-phosphofructokinase subunit (Lactococcus lactis)
6-phosphofructokinase. [EC: 2.7.1.11]

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)

MetaCyc Pathways

• formaldehyde assimilation II (assimilatory RuMP Cycle) (9/9 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (13/17 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sedoheptulose bisphosphate bypass (2/2 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (3/4 steps found)
• 1,3-propanediol biosynthesis (engineered) (6/9 steps found)
• N-acetyl-D-galactosamine degradation (3/5 steps found)
• galactitol degradation (3/5 steps found)
• lactose degradation I (3/5 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.11

Use Curated BLAST to search for 2.7.1.11

Sequence Analysis Tools

See L0G016 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Echvi_2380 6-phosphofructokinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MESKAITKIGVLTSGGDAPGMNAAIRAVVRCAFYYNLEVYGIYRGYEGMIQNDIRQLNSS
DIAYVLERGGTFLKSARSAEFRTPEGRKKAYENLQQHGINGLVVIGGDGSLTGAHLFYKE
FGIPAIGLPGTIDNDLSGTDNTIGFDTACNTAIEAIDKIRDTATSHDRLFFVEVMGRDSG
FIAINAGIGSAAAATLIPEKKMPVEALIDRLNTRAKAKKQANVVIVAEGGKSGGALEISK
KVKKYLPNYDIKVTILGHLQRGGSPTSYDRVLASKLGVSAVEGLMQGKCDVMAGVINNKV
VYTPIKRAIVDDKEVDEEDFRVAKILST