Protein Info for Echvi_2376 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 34 to 482 (449 residues), 431 bits, see alignment E=4.6e-133 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 34 to 484 (451 residues), 441.4 bits, see alignment E=4e-136 PF00919: UPF0004" amino acids 34 to 133 (100 residues), 105.9 bits, see alignment E=1.4e-34 PF04055: Radical_SAM" amino acids 181 to 368 (188 residues), 92.1 bits, see alignment E=6.9e-30 PF01938: TRAM" amino acids 426 to 485 (60 residues), 49.6 bits, see alignment E=4.3e-17

Best Hits

Swiss-Prot: 68% identical to MIAB_AMOA5: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Amoebophilus asiaticus (strain 5a2)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 78% identity to mtt:Ftrac_0757)

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXJ7 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Echvi_2376 tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB (Echinicola vietnamensis KMM 6221, DSM 17526)
MENIIKDIDILPAEEAQACEFKTTEEENTGKQKKLYIESYGCQMNFSDSEIVASIMKKNG
FDTTSNFEQADVIFLNTCSIREKAELTVRKRLTQFNTIKKARPDLTIGVLGCMAERLKDK
LLEEEKLVDVVVGPDAYRDLPNLVKVAEEGDKGVNTFLSREETYADISPVRLNTNGVSAF
ISIMRGCDNMCSFCVVPFTRGRERSRDPHSIVKEAQELFDKGYKEVTLLGQNVDSYKWSP
EENNKARLNKQEEDVSEVINFANLLEMVAKVAPQLRVRFSTSHPKDITDEVLYTMKKYDN
ICKYIHLPVQSGNSRILDLMNRTYDREWYLERVAKIREILGQECGISSDMIAGFCSETEE
EHQETLSLMDIVKYDFSYMFFYSERPGTLAAKKYEDDIPLETKKRRLQEIIAKQTQHSLE
RNKLDLGQTQEVLVEGTSKRSEEQLKGRNSANKVVIFPKGNHKKGDYVRVKIVDCTAATL
FGEVLS