Protein Info for Echvi_2371 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Sterol desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 52 to 80 (29 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 147 to 176 (30 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 96 to 227 (132 residues), 98.5 bits, see alignment E=2.2e-32

Best Hits

KEGG orthology group: None (inferred from 49% identity to sli:Slin_1096)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXJ2 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Echvi_2371 Sterol desaturase (Echinicola vietnamensis KMM 6221, DSM 17526)
MFENYKTLEDIGATEWPNIILWAAPVMFALVFAEWGLSIYKNRDSYDGKDFLAASSIGLI
NVGISALIKVALFSAVLFFWNIVPWKIPPTWWSFIPCFIAIDFARYWAHRVAHEQRFWWA
THVTHHNSEKYNFSVSFRLSWTQHIKFIFFIPVVMIGFDPFVFFICHQIAVLYQFWIHTE
YIKKLPAPIEYIFTTPSHHRVHHASDEHYLDKNYGSTFIIWDRIFGTFMAEGETPNYGIT
KPVNSYNPVTLVFHEWYDIVKDLKQAENKNEAFKILFGKPGDEVIKNRELKRQEREEKAQ
KVNSPSPAPILTEKEPSLLQKEN