Protein Info for Echvi_2356 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: MiaB-like tRNA modifying enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 3 to 423 (421 residues), 385.2 bits, see alignment E=3.7e-119 PF00919: UPF0004" amino acids 3 to 98 (96 residues), 82.2 bits, see alignment E=2.2e-27 TIGR01579: MiaB-like tRNA modifying enzyme" amino acids 6 to 416 (411 residues), 418.8 bits, see alignment E=3e-129 PF04055: Radical_SAM" amino acids 146 to 318 (173 residues), 84.6 bits, see alignment E=9.3e-28

Best Hits

KEGG orthology group: None (inferred from 78% identity to mtt:Ftrac_0063)

Predicted SEED Role

"tRNA-t(6)A37 methylthiotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXI2 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Echvi_2356 MiaB-like tRNA modifying enzyme (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKVAFYTLGCKLNYSETSTISRQFEEKGYKKVGFEDTPDIFIINTCSVTENADKKCKKI
VKEAKKISPNSYVTIIGCYAQLKPKEISEIKGVDAVLGAAEKFRLIELLDGFAKEQETKI
LASEIQEATAFNNAFSMHDRTRTFLKVQDGCNYGCAFCTIPLARGKSRSDSIENILKSAR
EIAATDVKEVVLTGVNIGDFGIQGGKRKEKFVDLVQELDEIEGIDRFRISSIEPNLLTNE
IIEFASRSKRFVPHFHIPLQSGSNTILRKMGRRYLRELYVDRVSKIKSLMPHCCIGVDVI
VGFPGETEELFLETYNFLNELPVSYLHVFTYSERPNTRATEMDDVVPMKVRNQRSKMLRI
LSEKKKRLFYEQNLKGTFDVLFEEDIDNGMMHGFTENYVRVAAKYDPLLINEIKKVTLWE
INDKGTVDAVEPEIVYEQH