Protein Info for Echvi_2346 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: uncharacterized domain 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 TIGR00369: uncharacterized domain 1" amino acids 19 to 135 (117 residues), 133.4 bits, see alignment E=2e-43 PF03061: 4HBT" amino acids 50 to 128 (79 residues), 56.5 bits, see alignment E=1.5e-19

Best Hits

Swiss-Prot: 56% identical to MENI_ECOLI: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (menI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 60% identity to rmr:Rmar_1468)

MetaCyc: 56% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

"1,4-dihydroxy-2-naphthoyl-CoA hydrolase (EC 3.1.2.28) in menaquinone biosynthesis" (EC 3.1.2.28)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXH7 at UniProt or InterPro

Protein Sequence (141 amino acids)

>Echvi_2346 uncharacterized domain 1 (Echinicola vietnamensis KMM 6221, DSM 17526)
MIFPKNLSLDTLNQFGKGNMLEHLGIVFTKIGDDFIEATMPVDQRTKQPFGLLHGGASVV
LAETLGSVASSCCVDPAKQYCIGLDINANHIKAVRDGLVRGIATPIHLGKKTHVWEIKIL
TEEDQLACISRITMAVLDKKS