Protein Info for Echvi_2342 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Beta-lactamase class C and other penicillin binding proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00144: Beta-lactamase" amino acids 50 to 420 (371 residues), 249.8 bits, see alignment E=2.2e-78

Best Hits

KEGG orthology group: None (inferred from 68% identity to fbc:FB2170_04350)

Predicted SEED Role

"Beta-lactamase" in subsystem Beta-lactamase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G181 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Echvi_2342 Beta-lactamase class C and other penicillin binding proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MKRIYIAIVCWMAMASVNAQTKSSQHSPELSEAAPRSVGMSDERLKKISNMLQEEVSKGN
IPGAVALIAKDGKIVYHEAFGQADNQASEKMETNSIFRIASQTKAITSTAVMMLWEEGKF
QLDDPISKYIPEFEDPQVLAGFKYADTTYTTVPADNEITIRHLLTHTSGLGYGVIDRDER
MKMIYHKAGITDLFTTKPITIGESVRKLAELPLHFTPGEQYSYSEGLDVLGYFVEVISGQ
PYDEFLKEHIFDPLGMEDTWFYLPEDKADRLVTVQHKMNGEWQPYPVTFYDTEYPVKGAK
TFFSGGAGLSSTAKDYATFLQMYLNGGELNGVRLLSRTTVRSIMGNQTGALFGGDGQYYG
LAFGVVTAEGEASGGMGSEGTFDWGGYFNTQYFADPKEQVIGVLMKQTQEPVDDQTGWKF
RQMVGAAIDD